DroSpeGe About Arthropods BLAST BioMart Maps Data News

Gene Function Associations in Species Genomes

Deviations in gene matches for GO categories by species genomes.

These deviations suggest where species may differ in biological function groups.
Target species genomes: Dro.mel, Dro.sim, Dro.sec, Dro.yak, Dro.ere, Dro.ana, Dro.per, Dro.pse, Dro.wil, Dro.moj, Dro.vir, Dro.gri
Source proteome: Worm [version 9g3]
Click on term for detailed information, or see here.
GO ID  
dmeldsimdsecdyakderedanadperdpsedwildmojdvirdgri
Term & Grouping
GO:0003677 DNA binding F : binding
GO:0003723 RNA binding F : binding
GO:0005544 calcium-dependent phospholipid binding F : binding
GO:0008289 lipid binding F : binding
GO:0020037 heme binding F : binding
GO:0048037 cofactor binding F : binding
GO:0003964 RNA-directed DNA polymerase activity F : catalytic activity
GO:0003995 acyl-CoA dehydrogenase activity F : catalytic activity
GO:0003997 acyl-CoA oxidase activity F : catalytic activity
GO:0004046 aminoacylase activity F : catalytic activity
GO:0004104 cholinesterase activity F : catalytic activity
GO:0004175 endopeptidase activity F : catalytic activity
GO:0004190 aspartic-type endopeptidase activity F : catalytic activity
GO:0004298 threonine endopeptidase activity F : catalytic activity
GO:0004559 alpha-mannosidase activity F : catalytic activity
GO:0004623 phospholipase A2 activity F : catalytic activity
GO:0008378 galactosyltransferase activity F : catalytic activity
GO:0008417 fucosyltransferase activity F : catalytic activity
GO:0008533 astacin activity F : catalytic activity
GO:0015923 mannosidase activity F : catalytic activity
GO:0016758 transferase activity, transferring hexosyl groups F : catalytic activity
GO:0016847 1-aminocyclopropane-1-carboxylate synthase activity F : catalytic activity
GO:0001584 rhodopsin-like receptor activity F : signal transducer activity
GO:0004930 G-protein coupled receptor activity F : signal transducer activity
GO:0004970 ionotropic glutamate receptor activity F : signal transducer activity
GO:0004983 neuropeptide Y receptor activity F : signal transducer activity
GO:0008227 amine receptor activity F : signal transducer activity
GO:0005215 transporter activity F : transporter activity
GO:0005234 glutamate-gated ion channel activity F : transporter activity
GO ID  
dmeldsimdsecdyakderedanadperdpsedwildmojdvirdgri
Term & Grouping
GO:0008150 biological_process P :
GO:0007218 neuropeptide signaling pathway P : cellular process
GO:0006013 mannose metabolism P : physiological process
GO:0006278 RNA-dependent DNA replication P : physiological process
GO:0006310 DNA recombination P : physiological process
GO:0006334 nucleosome assembly P : physiological process
GO:0006486 protein amino acid glycosylation P : physiological process
GO:0006511 ubiquitin-dependent protein catabolism P : physiological process
GO:0006626 protein targeting to mitochondrion P : physiological process
GO:0006635 fatty acid beta-oxidation P : physiological process
GO:0006810 transport P : physiological process
GO:0006911 phagocytosis, engulfment P : physiological process
GO:0006997 nuclear organization and biogenesis P : physiological process
GO:0007001 chromosome organization and biogenesis (sensu Eukaryota) P : physiological process
GO:0016042 lipid catabolism P : physiological process
GO:0018987 osmoregulation P : physiological process
GO:0040002 cuticle biosynthesis (sensu Nematoda) P : physiological process
GO:0040004 cuticular attachment to epithelium (sensu Nematoda) P : physiological process
GO:0042157 lipoprotein metabolism P : physiological process
GO:0045039 protein import into mitochondrial inner membrane P : physiological process
GO:0040008 regulation of growth P : regulation of biological process
GO ID  
dmeldsimdsecdyakderedanadperdpsedwildmojdvirdgri
Term & Grouping
GO:0016021 integral to membrane C : cell part
GO:0030117 membrane coat C : cell part
GO:0031012 extracellular matrix C : extracellular matrix
GO:0005777 peroxisome C : organelle
GO:0000786 nucleosome C : protein complex
GO:0005839 proteasome core complex (sensu Eukaryota) C : protein complex
GO:0042721 mitochondrial inner membrane protein insertion complex C : protein complex
 
dmeldsimdsecdyakderedanadperdpsedwildmojdvirdgri

Find crosstable statistics here.

No significant deviations for n= 514 categories.

Developed at the Genome Informatics Lab of Indiana University Biology Department