DroSpeGe About Arthropods BLAST BioMart Maps Data News

Gene Function Associations in Species Genomes

Deviations in gene matches for GO categories by species genomes.

These deviations suggest where species may differ in biological function groups.
Target species genomes: Dro.mel, Dro.sim, Dro.sec, Dro.yak, Dro.ere, Dro.ana, Dro.per, Dro.pse, Dro.wil, Dro.moj, Dro.vir, Dro.gri
Source proteome: Fruitfly [version 9g3]
Click on term for detailed information, or see here.
GO ID  
dmeldsimdsecdyakderedanadperdpsedwildmojdvirdgri
Term & Grouping
GO:0005554 molecular_function [alt] F :
GO:0004602 glutathione peroxidase activity F : antioxidant activity
GO:0003725 double-stranded RNA binding F : binding
GO:0005102 receptor binding F : binding
GO:0005488 binding F : binding
GO:0005506 iron ion binding F : binding
GO:0005534 galactose binding F : binding
GO:0000163 protein phosphatase type 1 activity F : catalytic activity
GO:0004091 carboxylesterase activity F : catalytic activity
GO:0004252 serine-type endopeptidase activity F : catalytic activity
GO:0004263 chymotrypsin activity F : catalytic activity
GO:0004295 trypsin activity F : catalytic activity
GO:0004365 glyceraldehyde-3-phosphate dehydrogenase (phosphorylating) activity F : catalytic activity
GO:0004497 monooxygenase activity F : catalytic activity
GO:0004559 alpha-mannosidase activity F : catalytic activity
GO:0004656 procollagen-proline 4-dioxygenase activity F : catalytic activity
GO:0004842 ubiquitin-protein ligase activity F : catalytic activity
GO:0008236 serine-type peptidase activity F : catalytic activity
GO:0008376 acetylgalactosaminyltransferase activity F : catalytic activity
GO:0008378 galactosyltransferase activity F : catalytic activity
GO:0008499 UDP-galactose:beta-N-acetylglucosamine beta-1,3-galactosyltransferase activity F : catalytic activity
GO:0016207 4-coumarate-CoA ligase activity F : catalytic activity
GO:0016401 palmitoyl-CoA oxidase activity F : catalytic activity
GO:0016706 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, 2-oxoglutarate as one donor, and incorporation of one atom each of oxygen into both donors F : catalytic activity
GO:0016740 transferase activity F : catalytic activity
GO:0016747 transferase activity, transferring groups other than amino-acyl groups F : catalytic activity
GO:0016757 transferase activity, transferring glycosyl groups F : catalytic activity
GO:0016874 ligase activity F : catalytic activity
GO:0016919 nardilysin activity F : catalytic activity
GO:0016984 ribulose-bisphosphate carboxylase activity F : catalytic activity
GO:0042708 elastase activity F : catalytic activity
GO:0046920 alpha(1,3)-fucosyltransferase activity F : catalytic activity
GO:0008605 protein kinase CK2 regulator activity F : enzyme regulator activity
GO:0008046 axon guidance receptor activity F : signal transducer activity
GO:0003702 RNA polymerase II transcription factor activity F : transcription regulator activity
GO:0005245 voltage-gated calcium channel activity F : transporter activity
GO:0005316 high affinity inorganic phosphate:sodium symporter activity F : transporter activity
GO:0005324 long-chain fatty acid transporter activity F : transporter activity
GO:0015276 ligand-gated ion channel activity F : transporter activity
GO:0015450 protein translocase activity F : transporter activity
GO:0016065 NA NA :
GO ID  
dmeldsimdsecdyakderedanadperdpsedwildmojdvirdgri
Term & Grouping
GO:0000004 biological_process [alt] P :
GO:0007224 smoothened signaling pathway P : cellular process
GO:0007270 nerve-nerve synaptic transmission P : cellular process
GO:0002009 morphogenesis of an epithelium P : development
GO:0007164 establishment of tissue polarity P : development
GO:0007422 peripheral nervous system development P : development
GO:0007432 salivary gland determination P : development
GO:0035152 regulation of tracheal tube architecture P : development
GO:0000281 cytokinesis after mitosis P : physiological process
GO:0005976 polysaccharide metabolism P : physiological process
GO:0006118 electron transport P : physiological process
GO:0006334 nucleosome assembly P : physiological process
GO:0006464 protein modification P : physiological process
GO:0006508 proteolysis P : physiological process
GO:0006511 ubiquitin-dependent protein catabolism P : physiological process
GO:0006732 coenzyme metabolism P : physiological process
GO:0006858 extracellular transport P : physiological process
GO:0007076 mitotic chromosome condensation P : physiological process
GO:0007141 male meiosis I P : physiological process
GO:0007594 puparial adhesion P : physiological process
GO:0008202 steroid metabolism P : physiological process
GO:0008363 larval cuticle biosynthesis (sensu Insecta) P : physiological process
GO:0008652 amino acid biosynthesis P : physiological process
GO:0009247 glycolipid biosynthesis P : physiological process
GO:0015977 carbon utilization by fixation of carbon dioxide P : physiological process
GO:0016246 RNA interference P : physiological process
GO:0016567 protein ubiquitination P : physiological process
GO:0018401 peptidyl-proline hydroxylation to 4-hydroxy-L-proline P : physiological process
GO:0019538 protein metabolism P : physiological process
GO:0030261 chromosome condensation P : physiological process
GO:0030422 RNA interference, production of siRNA P : physiological process
GO:0030423 RNA interference, targeting of mRNA for destruction P : physiological process
GO:0035087 RNA interference, siRNA loading onto RISC P : physiological process
GO:0048130 oocyte microtubule cytoskeleton organization (sensu Insecta) P : physiological process
GO:0051227 mitotic spindle assembly P : physiological process
GO:0051297 centrosome organization and biogenesis P : physiological process
GO:0006521 regulation of amino acid metabolism P : regulation of biological process
GO:0045861 negative regulation of proteolysis P : regulation of biological process
GO:0007283 spermatogenesis P : reproduction
GO:0030728 ovulation P : reproduction
GO:0007618 mating P : response to stimulus
GO:0042742 defense response to bacterium P : response to stimulus
GO:0045297 post-mating behavior P : response to stimulus
GO:0046692 sperm competition P : response to stimulus
GO ID  
dmeldsimdsecdyakderedanadperdpsedwildmojdvirdgri
Term & Grouping
GO:0008372 cellular_component [alt] C :
GO:0005792 microsome C : cell part
GO:0009573 ribulose bisphosphate carboxylase complex (sensu Magnoliophyta) C : cell part
GO:0016327 apicolateral plasma membrane C : cell part
GO:0018994 polar granule C : organelle
GO:0000151 ubiquitin ligase complex C : protein complex
GO:0000164 protein phosphatase type 1 complex C : protein complex
GO:0000786 nucleosome C : protein complex
GO:0005742 mitochondrial outer membrane translocase complex C : protein complex
GO:0005839 proteasome core complex (sensu Eukaryota) C : protein complex
GO:0005956 protein kinase CK2 complex C : protein complex
GO:0016222 procollagen-proline, 2-oxoglutarate-4-dioxygenase complex C : protein complex
GO:0016442 RNA-induced silencing complex C : protein complex
GO:0019005 SCF ubiquitin ligase complex C : protein complex
GO:0045202 synapse C : synapse
 
dmeldsimdsecdyakderedanadperdpsedwildmojdvirdgri

Find crosstable statistics here.

No significant deviations for n= 1371 categories.

Developed at the Genome Informatics Lab of Indiana University Biology Department