DroSpeGe About Arthropods BLAST BioMart Maps Data News

Number of gene matches (HSP groups) to Gene Ontology classes
in Drosophila species genomes
GO_CellLocation category, Mouse,Worm,Yeast proteome

Legend: Blue bars: Mean gene count +/- 90% confidence interval
Red circle: expected value (population mean)

Golgi apparatus cell cell wall
cellular_component cellular_component unknown chromosome cytoplasm cytoplasmic vesicle
cytoskeleton cytosol endoplasmic reticulum endosome external encapsulating structure
extracellular matrix (sensu Metazoa) extracellular region extracellular space intracellular lipid particle
lysosome mitochondrion nuclear chromosome nuclear membrane nucleolus
nucleoplasm nucleus peroxisome plasma membrane plastid
ribosome unlocalized protein complex vacuole

GO:0000228 nuclear chromosome


GO:0000228 Significant 11 of 85 total genes, contributing to ngenes deviation
Querydmeldsimdsecdyakderedanadperdpsedwildmojdvirdgri
S000002633311222311111
S000000662221145221333
S000001532125232112111
S000001515222222112113
S000000099259188211610511111415
S00000009824917520158811121619
S0000026322410195201510713131719
S000000479101000000000
S0000002132510198201612812131416
S0000049752510198201612812131416
S0000049762511176191515812161922

GO:0005575 cellular_component

No significant difference from population mean. See means plot

GO:0005576 extracellular region

No significant difference from population mean. See means plot

GO:0005578 extracellular matrix (sensu Metazoa)


GO:0005578 Significant 11 of 67 total genes, contributing to ngenes deviation
Querydmeldsimdsecdyakderedanadperdpsedwildmojdvirdgri
MGI:1339949111311223232
MGI:1349390112121323221
MGI:109249112321333133
WBGene00020646111331222121
MGI:1347356111422234223
MGI:109343223311223332
MGI:1916320111231332121
MGI:1353468111111222212
MGI:1346321111111123112
MGI:2447899112111327211
MGI:102889112211112123

GO:0005615 extracellular space

No significant difference from population mean. See means plot

GO:0005618 cell wall

No significant difference from population mean. See means plot

GO:0005622 intracellular


GO:0005622 Significant 11 of 889 total genes, contributing to ngenes deviation
Querydmeldsimdsecdyakderedanadperdpsedwildmojdvirdgri
MGI:98105111111222111
MGI:1913434111111221111
MGI:1928139111111221111
S000005583111111221111
WBGene00010476111111221111
WBGene00013201111111221111
MGI:1298220111112222121
MGI:1888676111111231111
MGI:1922673111111231111
WBGene00004496111111231111
MGI:108070111111321111

GO:0005623 cell

No significant difference from population mean. See means plot

GO:0005634 nucleus


GO:0005634 Significant 11 of 4526 total genes, contributing to ngenes deviation
Querydmeldsimdsecdyakderedanadperdpsedwildmojdvirdgri
MGI:97791212121111112
MGI:108247212121111111
MGI:109349212121111111
MGI:107533222122111111
MGI:1913714212121112111
MGI:1914923212111111112
WBGene00003976212111111112
MGI:1100882211122111111
MGI:1347472212111111111
MGI:1931050212111111111
S000003095212111111111

GO:0005635 nuclear membrane


GO:0005635 Significant 6 of 49 total genes, contributing to ngenes deviation
Querydmeldsimdsecdyakderedanadperdpsedwildmojdvirdgri
WBGene00003796111111114111
S000004650111112113111
MGI:2443767222222224121
S000001057233331113212
S000003351222232244311
S00000260022532230374311

GO:0005654 nucleoplasm

No significant difference from population mean. See means plot

GO:0005694 chromosome

No significant difference from population mean. See means plot

GO:0005730 nucleolus

No significant difference from population mean. See means plot

GO:0005737 cytoplasm

No significant difference from population mean. See means plot

GO:0005739 mitochondrion


GO:0005739 Significant 11 of 1149 total genes, contributing to ngenes deviation
Querydmeldsimdsecdyakderedanadperdpsedwildmojdvirdgri
MGI:894645111211212121
S000005702111111212111
MGI:97356111111223121
S000001675111111213111
S000000176111111222111
MGI:2442496111111113121
MGI:96247111111112121
S000002468111111112121
S000004271111111112121
WBGene00021133111111112121
MGI:1914380121111222121

GO:0005764 lysosome

No significant difference from population mean. See means plot

GO:0005768 endosome

No significant difference from population mean. See means plot

GO:0005773 vacuole


GO:0005773 Significant 7 of 123 total genes, contributing to ngenes deviation
Querydmeldsimdsecdyakderedanadperdpsedwildmojdvirdgri
S000002974377782212627
S000004856244225222345
S000002535113111111113
S00000397196159101123101369
S000003938481171013241113810
S000002281001860400017105543
S000002692768987766669

GO:0005777 peroxisome

No significant difference from population mean. See means plot

GO:0005783 endoplasmic reticulum

No significant difference from population mean. See means plot

GO:0005794 Golgi apparatus


GO:0005794 Significant 11 of 160 total genes, contributing to ngenes deviation
Querydmeldsimdsecdyakderedanadperdpsedwildmojdvirdgri
MGI:1927753131111111111
MGI:97388130111111111
S000004160121111112111
S000001776122111111111
MGI:1351486222121111211
MGI:1914652111111111211
MGI:1916233111111111211
MGI:2450915111111111211
WBGene00000160121111112121
MGI:104563111211111111
S000000458111211111111

GO:0005811 lipid particle

No significant difference from population mean. See means plot

GO:0005829 cytosol


GO:0005829 Significant 11 of 385 total genes, contributing to ngenes deviation
Querydmeldsimdsecdyakderedanadperdpsedwildmojdvirdgri
S000002233111111222111
S000004398111111222111
MGI:1926334112211321211
S000004332111211331111
S000001906111111223211
MGI:1914719111111231111
S000000188111111231111
WBGene00013435111111343111
MGI:2651573111111221111
S000000215111111221111
S000003446111111221111

GO:0005840 ribosome


GO:0005840 Significant 3 of 9 total genes, contributing to ngenes deviation
Querydmeldsimdsecdyakderedanadperdpsedwildmojdvirdgri
S00000518811111210103333
S000002793254432344554
S000005659254432344554

GO:0005856 cytoskeleton


GO:0005856 Significant 11 of 523 total genes, contributing to ngenes deviation
Querydmeldsimdsecdyakderedanadperdpsedwildmojdvirdgri
WBGene00000257112212222112
S000001531112222322221
MGI:106621114342213223
WBGene00000067112232112211
MGI:107979112222122111
MGI:103006113122222322
MGI:2183752111121223212
S000000174222222332223
MGI:106612111223224324
MGI:109547114221331122
WBGene00009730224343333322

GO:0005886 plasma membrane

No significant difference from population mean. See means plot

GO:0005929

No significant difference from population mean. See means plot

GO:0005941 unlocalized protein complex


GO:0005941 Significant 11 of 62 total genes, contributing to ngenes deviation
Querydmeldsimdsecdyakderedanadperdpsedwildmojdvirdgri
WBGene00019225111111222113
MGI:892979111111117112
WBGene00021753221112221112
MGI:97579211111111314
MGI:1914304543122116111
MGI:101913111111113111
WBGene00018362111111111113
MGI:1916211211112331317
WBGene00015116543212117121
WBGene00013049111111111213
WBGene00012348411234432212

GO:0008372 cellular_component unknown


GO:0008372 Significant 11 of 1665 total genes, contributing to ngenes deviation
Querydmeldsimdsecdyakderedanadperdpsedwildmojdvirdgri
MGI:1918685111111111121
MGI:1924587111111111121
MGI:1925016111111111121
MGI:2148802111111111121
MGI:3051498111111111121
S000004823111111111121
S000006034111111111121
S000004233111111111131
MGI:1352507111111111141
MGI:1918898111211111121
MGI:107891111112111121

GO:0009536 plastid

Data is too limited to test.

GO:0016023 cytoplasmic vesicle

No significant difference from population mean. See means plot

GO:0030312 external encapsulating structure


GO:0030312 Significant 2 of 2 total genes, contributing to ngenes deviation
Querydmeldsimdsecdyakderedanadperdpsedwildmojdvirdgri
WBGene00022820000000000000
WBGene00022822000000000000

GO:0030313

No significant difference from population mean. See means plot

Developed at the Genome Informatics Lab of Indiana University Biology Department