DroSpeGe About BLAST BioMart Maps Data News

Gene Function Associations in Species Genomes

Deviations in gene matches for GO categories by species genomes.

These deviations suggest where species may differ in biological function groups.
Target species genomes: Dro.mel, Dro.sim, Dro.sec, Dro.yak, Dro.ere, Dro.ana, Dro.per, Dro.pse, Dro.wil, Dro.moj, Dro.vir, Dro.gri
Source proteome: Mouse [version 9g3]
Click on term for detailed information, or see here.
GO ID  
dmeldsimdsecdyakderedanadperdpsedwildmojdvirdgri
Term & Grouping
GO:0003743 translation initiation factor activity F : binding
GO:0005041 low-density lipoprotein receptor activity F : binding
GO:0005178 integrin binding F : binding
GO:0005179 hormone activity F : binding
GO:0005515 protein binding F : binding
GO:0005529 sugar binding F : binding
GO:0005537 mannose binding F : binding
GO:0005544 calcium-dependent phospholipid binding F : binding
GO:0008143 poly(A) binding F : binding
GO:0019838 growth factor binding F : binding
GO:0030151 molybdenum ion binding F : binding
GO:0050661 NADP binding F : binding
GO:0004016 adenylate cyclase activity F : catalytic activity
GO:0004031 aldehyde oxidase activity F : catalytic activity
GO:0004104 cholinesterase activity F : catalytic activity
GO:0004175 endopeptidase activity F : catalytic activity
GO:0004179 membrane alanyl aminopeptidase activity F : catalytic activity
GO:0004180 carboxypeptidase activity F : catalytic activity
GO:0004182 carboxypeptidase A activity F : catalytic activity
GO:0004190 aspartic-type endopeptidase activity F : catalytic activity
GO:0004222 metalloendopeptidase activity F : catalytic activity
GO:0004245 neprilysin activity F : catalytic activity
GO:0004252 serine-type endopeptidase activity F : catalytic activity
GO:0004263 chymotrypsin activity F : catalytic activity
GO:0004295 trypsin activity F : catalytic activity
GO:0004298 threonine endopeptidase activity F : catalytic activity
GO:0004559 alpha-mannosidase activity F : catalytic activity
GO:0004653 polypeptide N-acetylgalactosaminyltransferase activity F : catalytic activity
GO:0004840 ubiquitin conjugating enzyme activity F : catalytic activity
GO:0004842 ubiquitin-protein ligase activity F : catalytic activity
GO:0008132 pancreatic elastase activity F : catalytic activity
GO:0008233 peptidase activity F : catalytic activity
GO:0008236 serine-type peptidase activity F : catalytic activity
GO:0008237 metallopeptidase activity F : catalytic activity
GO:0008499 UDP-galactose:beta-N-acetylglucosamine beta-1,3-galactosyltransferase activity F : catalytic activity
GO:0015923 mannosidase activity F : catalytic activity
GO:0016491 oxidoreductase activity F : catalytic activity
GO:0016624 oxidoreductase activity, acting on the aldehyde or oxo group of donors, disulfide as acceptor F : catalytic activity
GO:0016709 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, NADH or NADPH as one donor, and incorporation of one atom of oxygen F : catalytic activity
GO:0016757 transferase activity, transferring glycosyl groups F : catalytic activity
GO:0016789 carboxylic ester hydrolase activity F : catalytic activity
GO:0018685 alkane 1-monooxygenase activity F : catalytic activity
GO:0035250 UDP-galactosyltransferase activity F : catalytic activity
GO:0050381 unspecific monooxygenase activity F : catalytic activity
GO:0005085 guanyl-nucleotide exchange factor activity F : enzyme regulator activity
GO:0030414 protease inhibitor activity F : enzyme regulator activity
GO:0045735 nutrient reservoir activity F : nutrient reservoir activity
GO:0001584 rhodopsin-like receptor activity F : signal transducer activity
GO:0004871 signal transducer activity F : signal transducer activity
GO:0004872 receptor activity F : signal transducer activity
GO:0004890 GABA-A receptor activity F : signal transducer activity
GO:0004930 G-protein coupled receptor activity F : signal transducer activity
GO:0004935 adrenoceptor activity F : signal transducer activity
GO:0004936 alpha-adrenergic receptor activity F : signal transducer activity
GO:0004952 dopamine receptor activity F : signal transducer activity
GO:0004984 olfactory receptor activity F : signal transducer activity
GO:0004993 serotonin receptor activity F : signal transducer activity
GO:0004995 tachykinin receptor activity F : signal transducer activity
GO:0005044 scavenger receptor activity F : signal transducer activity
GO:0017154 semaphorin receptor activity F : signal transducer activity
GO:0030594 neurotransmitter receptor activity F : signal transducer activity
GO:0030020 extracellular matrix structural constituent conferring tensile strength F : structural molecule activity
GO:0016563 transcriptional activator activity F : transcription regulator activity
GO:0005230 extracellular ligand-gated ion channel activity F : transporter activity
GO:0005245 voltage-gated calcium channel activity F : transporter activity
GO:0005262 calcium channel activity F : transporter activity
GO:0005302 L-tyrosine transporter activity F : transporter activity
GO:0005319 lipid transporter activity F : transporter activity
GO:0005391 sodium:potassium-exchanging ATPase activity F : transporter activity
GO:0008273 calcium, potassium:sodium antiporter activity F : transporter activity
GO:0015077 monovalent inorganic cation transporter activity F : transporter activity
GO:0015114 phosphate transporter activity F : transporter activity
GO:0015180 L-alanine transporter activity F : transporter activity
GO:0015193 L-proline transporter activity F : transporter activity
GO:0016934 glycine-gated chloride channel activity F : transporter activity
GO ID  
dmeldsimdsecdyakderedanadperdpsedwildmojdvirdgri
Term & Grouping
GO:0001504 neurotransmitter uptake P : cellular process
GO:0007160 cell-matrix adhesion P : cellular process
GO:0007169 transmembrane receptor protein tyrosine kinase signaling pathway P : cellular process
GO:0007186 G-protein coupled receptor protein signaling pathway P : cellular process
GO:0007188 G-protein signaling, coupled to cAMP nucleotide second messenger P : cellular process
GO:0007229 integrin-mediated signaling pathway P : cellular process
GO:0007266 Rho protein signal transduction P : cellular process
GO:0007268 synaptic transmission P : cellular process
GO:0016337 cell-cell adhesion P : cellular process
GO:0016601 Rac protein signal transduction P : cellular process
GO:0030154 cell differentiation P : cellular process
GO:0001503 ossification P : development
GO:0001525 angiogenesis P : development
GO:0045766 positive regulation of angiogenesis P : development
GO:0000059 protein import into nucleus, docking P : physiological process
GO:0000103 sulfate assimilation P : physiological process
GO:0001539 ciliary or flagellar motility P : physiological process
GO:0005977 glycogen metabolism P : physiological process
GO:0006013 mannose metabolism P : physiological process
GO:0006171 cAMP biosynthesis P : physiological process
GO:0006334 nucleosome assembly P : physiological process
GO:0006397 mRNA processing P : physiological process
GO:0006471 protein amino acid ADP-ribosylation P : physiological process
GO:0006508 proteolysis P : physiological process
GO:0006512 ubiquitin cycle P : physiological process
GO:0006695 cholesterol biosynthesis P : physiological process
GO:0006812 cation transport P : physiological process
GO:0006814 sodium ion transport P : physiological process
GO:0006817 phosphate transport P : physiological process
GO:0006874 calcium ion homeostasis P : physiological process
GO:0006956 complement activation P : physiological process
GO:0006958 complement activation, classical pathway P : physiological process
GO:0007001 chromosome organization and biogenesis (sensu Eukaryota) P : physiological process
GO:0007009 plasma membrane organization and biogenesis P : physiological process
GO:0007411 axon guidance P : physiological process
GO:0007601 visual perception P : physiological process
GO:0009312 oligosaccharide biosynthesis P : physiological process
GO:0015672 monovalent inorganic cation transport P : physiological process
GO:0015711 organic anion transport P : physiological process
GO:0015800 acidic amino acid transport P : physiological process
GO:0015808 L-alanine transport P : physiological process
GO:0015824 proline transport P : physiological process
GO:0015991 ATP hydrolysis coupled proton transport P : physiological process
GO:0016926 protein desumoylation P : physiological process
GO:0019835 cytolysis P : physiological process
GO:0030574 collagen catabolism P : physiological process
GO:0042744 hydrogen peroxide catabolism P : physiological process
GO:0050885 regulation of balance P : physiological process
GO:0050974 detection of mechanical stimulus during sensory perception P : physiological process
GO:0051325 interphase P : physiological process
GO:0016481 negative regulation of transcription P : regulation of biological process
GO:0042108 positive regulation of cytokine biosynthesis P : regulation of biological process
GO:0045595 regulation of cell differentiation P : regulation of biological process
GO:0045941 positive regulation of transcription P : regulation of biological process
GO:0046324 regulation of glucose import P : regulation of biological process
GO:0006935 chemotaxis P : response to stimulus
GO:0006953 acute-phase response P : response to stimulus
GO:0007602 phototransduction P : response to stimulus
GO:0007611 learning and/or memory P : response to stimulus
GO:0007613 memory P : response to stimulus
GO:0008344 adult locomotory behavior P : response to stimulus
GO:0009605 response to external stimulus P : response to stimulus
GO:0042221 response to chemical stimulus P : response to stimulus
GO ID  
dmeldsimdsecdyakderedanadperdpsedwildmojdvirdgri
Term & Grouping
GO:0000139 Golgi membrane C : cell part
GO:0005911 intercellular junction C : cell part
GO:0009986 cell surface C : cell part
GO:0019866 organelle inner membrane C : cell part
GO:0030027 lamellipodium C : cell part
GO:0030054 cell junction C : cell part
GO:0030425 dendrite C : cell part
GO:0030672 synaptic vesicle membrane C : cell part
GO:0005635 nuclear envelope C : envelope
GO:0005581 collagen C : extracellular matrix part
GO:0005578 extracellular matrix (sensu Metazoa) C : extracellular matrix
GO:0005615 extracellular space C : extracellular region part
GO:0044421 extracellular region part C : extracellular region part
GO:0005576 extracellular region C : extracellular region
GO:0000775 chromosome, pericentric region C : organelle part
GO:0005882 intermediate filament C : organelle part
GO:0001533 cornified envelope C : organelle
GO:0005694 chromosome C : organelle
GO:0000786 nucleosome C : protein complex
GO:0005643 nuclear pore C : protein complex
GO:0005667 transcription factor complex C : protein complex
GO:0005839 proteasome core complex (sensu Eukaryota) C : protein complex
GO:0005891 voltage-gated calcium channel complex C : protein complex
 
dmeldsimdsecdyakderedanadperdpsedwildmojdvirdgri

Find crosstable statistics here.

No significant deviations for n= 943 categories.

Developed at the Genome Informatics Lab of Indiana University Biology Department